![]() |
Plant Transcription
Factor Database
v4.0
Previous version:
v3.0
|
Home BLAST Prediction RegMap ATRM Download Help About Links |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | EPS60416.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 144aa MW: 16315.4 Da PI: 10.7431 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 41.7 | 2.6e-13 | 67 | 111 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +W++eE++ ++ + ++ G+g+W+ I+r k+Rt+ q+ s+ qky EPS60416.1 67 PWSEEEHLMFLLGLQKVGKGDWRGISRNYVKTRTPTQVASHAQKY 111 8*******************************************9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 15.736 | 60 | 116 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.64E-16 | 62 | 117 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 2.9E-17 | 63 | 114 | IPR006447 | Myb domain, plants |
SMART | SM00717 | 3.5E-9 | 64 | 114 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.8E-10 | 66 | 111 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.20E-9 | 67 | 112 | No hit | No description |
Pfam | PF00249 | 1.2E-10 | 67 | 111 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009723 | Biological Process | response to ethylene | ||||
GO:0009733 | Biological Process | response to auxin | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0009739 | Biological Process | response to gibberellin | ||||
GO:0009751 | Biological Process | response to salicylic acid | ||||
GO:0009753 | Biological Process | response to jasmonic acid | ||||
GO:0031540 | Biological Process | regulation of anthocyanin biosynthetic process | ||||
GO:0046686 | Biological Process | response to cadmium ion | ||||
GO:0080167 | Biological Process | response to karrikin | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003682 | Molecular Function | chromatin binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 144 aa Download sequence Send to blast |
GEKGFMLFGV RVMTEGSLRK SASMDNLALF DLQPRESNPD AASAAGYASD DVVHLSARSR 60 DRKRGVPWSE EEHLMFLLGL QKVGKGDWRG ISRNYVKTRT PTQVASHAQK YFLRRNNHNR 120 RRRRSSLFDI TTETVVGSTG EEQM |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00630 | PBM | Transfer from PK17526.1 | Download |
![]() |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_011086441.1 | 5e-72 | PREDICTED: transcription factor MYB1R1 | ||||
Swissprot | Q2V9B0 | 4e-41 | MY1R1_SOLTU; Transcription factor MYB1R1 | ||||
TrEMBL | S8C7T2 | 1e-104 | S8C7T2_9LAMI; Uncharacterized protein (Fragment) | ||||
STRING | Solyc04g005100.2.1 | 1e-60 | (Solanum lycopersicum) | ||||
STRING | POPTR_0008s19610.1 | 2e-60 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA11423 | 22 | 25 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G70000.2 | 4e-47 | MYB_related family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|