PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS60416.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family MYB_related
Protein Properties Length: 144aa    MW: 16315.4 Da    PI: 10.7431
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS60416.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding41.72.6e-1367111347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +W++eE++ ++ + ++ G+g+W+ I+r   k+Rt+ q+ s+ qky
       EPS60416.1  67 PWSEEEHLMFLLGLQKVGKGDWRGISRNYVKTRTPTQVASHAQKY 111
                      8*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.73660116IPR017930Myb domain
SuperFamilySSF466891.64E-1662117IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-1763114IPR006447Myb domain, plants
SMARTSM007173.5E-964114IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.601.8E-1066111IPR009057Homeodomain-like
CDDcd001671.20E-967112No hitNo description
PfamPF002491.2E-1067111IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009651Biological Processresponse to salt stress
GO:0009723Biological Processresponse to ethylene
GO:0009733Biological Processresponse to auxin
GO:0009737Biological Processresponse to abscisic acid
GO:0009739Biological Processresponse to gibberellin
GO:0009751Biological Processresponse to salicylic acid
GO:0009753Biological Processresponse to jasmonic acid
GO:0031540Biological Processregulation of anthocyanin biosynthetic process
GO:0046686Biological Processresponse to cadmium ion
GO:0080167Biological Processresponse to karrikin
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003682Molecular Functionchromatin binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 144 aa     Download sequence    Send to blast
GEKGFMLFGV RVMTEGSLRK SASMDNLALF DLQPRESNPD AASAAGYASD DVVHLSARSR  60
DRKRGVPWSE EEHLMFLLGL QKVGKGDWRG ISRNYVKTRT PTQVASHAQK YFLRRNNHNR  120
RRRRSSLFDI TTETVVGSTG EEQM
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00630PBMTransfer from PK17526.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011086441.15e-72PREDICTED: transcription factor MYB1R1
SwissprotQ2V9B04e-41MY1R1_SOLTU; Transcription factor MYB1R1
TrEMBLS8C7T21e-104S8C7T2_9LAMI; Uncharacterized protein (Fragment)
STRINGSolyc04g005100.2.11e-60(Solanum lycopersicum)
STRINGPOPTR_0008s19610.12e-60(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA114232225
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G70000.24e-47MYB_related family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]